PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G72830.2
Common NameATHAP2C, HAP2C, NF-YA3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YA
Protein Properties Length: 341aa    MW: 37717.1 Da    PI: 10.1644
Description nuclear factor Y, subunit A3
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G72830.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.85.5e-31179235258
    CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +p++VNaKQy++I++RRq+Rakle+++kl  + + pylheSRh hAl+RpRgsgGrF
  AT1G72830.2 179 DPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKVPYLHESRHVHALKRPRGSGGRF 235
                  79***************************999999*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.4E-36176238IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.638177238IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-25180235IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-22180202IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860182202IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.7E-22212235IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MMHQMLNKKD SATHSTLPYL NTSISWGVVP TDSVANRRGS AESLSLKVDS RPGHIQTTKQ  60
ISFQDQDSSS TQSTGQSYTE VASSGDDNPS RQISFSAKSG SEITQRKGFA SNPKQGSMTG  120
FPNIHFAPAQ ANFSFHYADP HYGGLLAATY LPQAPTCNPQ MVSMIPGRVP LPAELTETDP  180
VFVNAKQYHA IMRRRQQRAK LEAQNKLIRA RKVPYLHESR HVHALKRPRG SGGRFLNTKK  240
LLQESEQAAA REQEQDKLGQ QVNRKTNMSR FEAHMLQNNK DRSSTTSGSD ITSVSDGADI  300
FGHTEFQFSG FPTPINRAML VHGQSNDMHG GGDMHHFSVH I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-17179239362NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.820.0leaf| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible262378_at0.0
Expression AtlasAT1G72830-
AtGenExpressAT1G72830-
ATTED-IIAT1G72830-
Functional Description ? help Back to Top
Source Description
TAIREncodes a subunit of CCAAT-binding complex, binds to CCAAT box motif present in some plant promoter sequences. One of three members of this class (HAP2A, HAP2B, HAP2C), it is expressed in vegetative and reproductive tissues.
Function -- GeneRIF ? help Back to Top
  1. The Arabidopsis NF-YA3 and NF-YA8 genes are functionally redundant and are required in early embryogenesis.
    [PMID: 24303077]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G72830.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G72830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1400280.0AY140028.1 Arabidopsis thaliana CCAAT-binding factor B subunit-like protein, putative (At1g72830) mRNA, complete cds.
GenBankBT0088250.0BT008825.1 Arabidopsis thaliana At1g72830 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974134.10.0nuclear transcription factor Y subunit A-3
SwissprotQ93ZH20.0NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLF4IEZ60.0F4IEZ6_ARATH; Nuclear transcription factor Y subunit A-3
STRINGAT1G72830.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Representative plantOGRP6801672
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hampton CR, et al.
    Cesium toxicity in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3824-37
    [PMID:15489280]
  3. Sottosanto JB,Gelli A,Blumwald E
    DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression.
    Plant J., 2004. 40(5): p. 752-71
    [PMID:15546358]
  4. Ronemus M,Vaughn MW,Martienssen RA
    MicroRNA-targeted and small interfering RNA-mediated mRNA degradation is regulated by argonaute, dicer, and RNA-dependent RNA polymerase in Arabidopsis.
    Plant Cell, 2006. 18(7): p. 1559-74
    [PMID:16798886]
  5. Chen NZ, et al.
    AtHAP3b plays a crucial role in the regulation of flowering time in Arabidopsis during osmotic stress.
    J. Biochem. Mol. Biol., 2007. 40(6): p. 1083-9
    [PMID:18047807]
  6. Yazawa K,Kamada H
    Identification and characterization of carrot HAP factors that form a complex with the embryo-specific transcription factor C-LEC1.
    J. Exp. Bot., 2007. 58(13): p. 3819-28
    [PMID:18057048]
  7. Liu TY, et al.
    Vacuolar Ca2+/H+ transport activity is required for systemic phosphate homeostasis involving shoot-to-root signaling in Arabidopsis.
    Plant Physiol., 2011. 156(3): p. 1176-89
    [PMID:21546457]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  9. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  10. Leyva-Gonz
    Functional and transcriptome analysis reveals an acclimatization strategy for abiotic stress tolerance mediated by Arabidopsis NF-YA family members.
    PLoS ONE, 2012. 7(10): p. e48138
    [PMID:23118940]
  11. Renault H, et al.
    γ-Aminobutyric acid transaminase deficiency impairs central carbon metabolism and leads to cell wall defects during salt stress in Arabidopsis roots.
    Plant Cell Environ., 2013. 36(5): p. 1009-18
    [PMID:23148892]
  12. Fornari M,Calvenzani V,Masiero S,Tonelli C,Petroni K
    The Arabidopsis NF-YA3 and NF-YA8 genes are functionally redundant and are required in early embryogenesis.
    PLoS ONE, 2013. 8(11): p. e82043
    [PMID:24303077]
  13. Edwards D,Murray JA,Smith AG
    Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis.
    Plant Physiol., 1998. 117(3): p. 1015-22
    [PMID:9662544]